Analytical Data
-
Gene name
ATP7a
- Application
-
Alternative Names
ATP7a；MC1；MNK；Copper-transporting ATPase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04656
-
Expression Region
1406-1500aa
-
AA Sequence
FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDR IVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP7A is a gene that encodes a copper-transporting ATPase, which is crucial for maintaining copper homeostasis in the body. Mutations in the ATP7A gene lead to Menkes disease, a severe neurodegenerative disorder characterized by copper deficiency resulting in developmental delays, neurological impairments, and impaired connective tissue function. The study of ATP7A recombinant proteins is fundamental for understanding the molecular mechanisms underlying copper transport and its role in cellular metabolism. By expressing and purifying ATP7A recombinant proteins, researchers can investigate the enzyme's functional properties, its interaction with various ligands, and the impact of specific mutations on its activity. Characterizing these proteins provides insights into the pathophysiology of Menkes disease, aids in the identification of potential therapeutic targets, and enhances our understanding of copper-related disorders. Additionally, studying ATP7A may help develop novel strategies for gene therapy and pharmacological interventions aimed at correcting copper imbalances in affected individuals. Overall, the investigation of ATP7A recombinant proteins is crucial for both basic research and the development of clinical applications related to copper homeostasis and its associated diseases.
