Analytical Data
-
Gene name
PPAP2C
- Application
-
Alternative Names
PPAP2C；LPP2；PPAP2C；Phospholipid phosphatase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43688
-
Expression Region
1-288aa
-
AA Sequence
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
-
Molecular Weight
32.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPAP2C, also known as phosphatidic acid phosphate 2C, is a member of the lipid phosphatase family involved in the regulation of various cellular processes, including lipid metabolism, cell signaling, and inflammation. The enzyme catalyzes the conversion of lysophosphatidic acid (LPA) and phosphatidic acid (PA) into their respective phosphate forms, thereby modulating the levels of bioactive lipids in cells. Dysregulation of PPAP2C has been implicated in various pathological conditions, such as cancer and cardiovascular diseases, making it a significant target for therapeutic intervention. Recent studies have focused on the recombinant expression of PPAP2C protein to facilitate detailed biochemical characterization, functional assays, and the exploration of its role in lipid metabolic pathways. By producing PPAP2C in a heterologous expression system, researchers can obtain large quantities of the protein for structural studies, high-throughput screening of inhibitors, and understanding its interaction with other signaling molecules. These efforts are crucial for elucidating the mechanistic pathways involving PPAP2C, which may lead to the development of novel therapeutic strategies aimed at diseases associated with dysregulated lipid signaling.
