Analytical Data
-
Gene name
TPD52L1
- Application
-
Alternative Names
TPD52L1;Tumor Protein D53
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16890
-
Expression Region
1-144aa
-
AA Sequence
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
-
Molecular Weight
49.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPD52L1 (Tumor Protein D52-Like 1) is a member of the D52 family of proteins, which are implicated in various cellular processes, including cell proliferation, apoptosis, and tumorigenesis. Research has shown that TPD52L1 is overexpressed in several types of cancers, suggesting its potential role as an oncogene and a biomarker for tumor progression. Understanding the molecular mechanisms by which TPD52L1 contributes to cancer biology is crucial for developing targeted therapies. Recent studies have focused on elucidating its structural characteristics and functional interactions at the cellular level, particularly in the context of signaling pathways that regulate cell growth and survival. The recombinant expression of TPD52L1 enables researchers to obtain the protein in sufficient quantities for biochemical assays and structural studies, facilitating the exploration of its potential as a therapeutic target. Additionally, examining TPD52L1's interactions with other oncogenic proteins may provide insights into its role in cancer metastasis and resistance to conventional treatments. Overall, the investigation of TPD52L1 represents a promising area of research in understanding cancer biology and developing novel interventions.











