Analytical Data
-
Gene name
P2RY5
- Application
-
Alternative Names
LPAR6; P2RY5; Lysophosphatidic acid receptor 6; LPA receptor 6; LPA-6; Oleoyl-L-alpha-lysophosphatidic acid receptor; P2Y purinoceptor 5; P2Y5; Purinergic receptor 5; RB intron encoded G-protein coupled receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43657
-
Expression Region
1-344 aa
-
AA Sequence
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
-
Molecular Weight
39.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The P2RY5 gene encodes a member of the purinergic receptor family, specifically the P2Y subfamily, which are G protein-coupled receptors activated by extracellular nucleotides such as ATP and ADP. Research into P2RY5 has gained attention due to its potential roles in various physiological processes and diseases, including immune responses, inflammation, and cancer. This receptor is primarily implicated in modulating cellular signaling pathways that influence cell proliferation, differentiation, and apoptosis. In particular, P2RY5 is thought to play a significant role in the activation of immune cells, making it a target of interest for therapeutic interventions. The recombinant expression of P2RY5 protein allows for detailed studies of its functional properties, pharmacological profiles, and interactions with other signaling molecules. Understanding the structure and function of P2RY5 through recombinant technology could pave the way for novel drug development aimed at modulating its activity in disease contexts, thus enhancing our knowledge of purinergic signaling in health and disease. Additionally, the study of P2RY5 may provide insights into the complexities of cellular communication and the potential for targeting these pathways in clinical settings. Overall, the exploration of P2RY5 as a recombinant protein represents a crucial step in unraveling its biological significance and therapeutic potential.
