Analytical Data
-
Gene name
P2RY4
- Application
-
Alternative Names
P2RY4; NRU; P2Y purinoceptor 4; P2Y4; P2P; Uridine nucleotide receptor; UNR
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51582
-
Expression Region
1-365 aa
-
AA Sequence
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP RADRL
-
Molecular Weight
40.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P2RY4, a member of the purinergic receptor family, encodes the adenosine receptor subtype P2Y4. This receptor is G protein-coupled and is primarily activated by extracellular nucleotides such as ATP and UTP. P2RY4 plays a vital role in various physiological processes, including cell signaling, immune responses, and inflammation regulation. Research has shown that P2RY4 is implicated in several pathophysiological conditions, including respiratory diseases and cancer, highlighting its potential as a therapeutic target. The study of P2RY4 recombinant protein is crucial for understanding its structure, function, and signaling mechanisms. By producing and characterizing P2RY4 in recombinant systems, researchers aim to dissect its interaction with ligands and downstream signaling pathways, paving the way for the development of novel therapeutic interventions. Furthermore, recombinant P2RY4 protein can serve as a valuable tool for drug discovery and screening assays, aiding in the identification of specific modulators that can enhance or inhibit its function. Understanding the nuances of P2RY4's role in cellular contexts will facilitate advancements in pharmacology and molecular medicine, ultimately contributing to improved strategies for managing diseases linked to purinergic signaling dysregulation.
