Analytical Data
-
Gene name
OXGR1
- Application
-
Alternative Names
OXGR1; GPR80; GPR99; P2RY15; P2Y15; 2-oxoglutarate receptor 1; Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; G-protein coupled receptor 99; P2Y purinoceptor 15; P2Y-like GPCR; P2Y-like nucleotide receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96P68
-
Expression Region
1-337 aa
-
AA Sequence
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIF KMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSS ILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNR SACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKAR RLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
-
Molecular Weight
38.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OXGR1, or OX glucose receptor 1, is a G protein-coupled receptor (GPCR) that has garnered attention due to its potential role in various physiological processes, including immune responses and neuronal signaling. This receptor is primarily activated by the metabolite 2-oxoglutarate, which is involved in cellular metabolism and energy regulation. The significance of OXGR1 in the context of metabolic diseases and neurological disorders has prompted researchers to investigate its signaling pathways and functional implications. The recombinant protein of OXGR1 allows for detailed studies of its structure-function relationship and aids in the exploration of its interactions with ligands and downstream signaling molecules. Understanding the biochemical properties of OXGR1 through recombinant expression systems could provide insights into how aberrations in its signaling might contribute to pathologies, thereby opening new avenues for therapeutic interventions targeting this receptor. Given the rising importance of GPCRs in drug discovery and development, the characterization of OXGR1 recombinant proteins represents a critical step in elucidating the receptor's biological roles and therapeutic potential.











