Analytical Data
-
Gene name
ACSL3
- Application
-
Alternative Names
ACSL3;ACS3;FACL3;LACS3;Fatty acid CoA ligase Acsl3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95573
-
Expression Region
42-720aa
-
AA Sequence
YFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
-
Molecular Weight
76.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACSL3, or acyl-CoA synthetase long-chain 3, is an enzyme that plays a crucial role in lipid metabolism by facilitating the conversion of long-chain fatty acids into acyl-CoA derivatives, which are essential for various cellular processes, including energy production, membrane synthesis, and signaling pathways. Research has increasingly focused on ACSL3 due to its involvement in metabolic disorders, obesity, and cancer, where altered fatty acid metabolism often contributes to disease progression. Elevated levels of ACSL3 have been associated with aggressive tumor phenotypes, indicating its potential as a biomarker for cancer prognosis and treatment response. Additionally, understanding the biochemical mechanisms by which ACSL3 operates can unveil new therapeutic targets for metabolic syndrome and related diseases. The reconstitution of ACSL3 as a recombinant protein allows for detailed studies of its enzymatic activity, substrate specificity, and regulation, which are pivotal for elucidating its biological functions and exploring its potential as a target in drug development. By utilizing techniques such as gene cloning, expression in heterologous systems, and purification, researchers aim to provide insights into the structural and functional characteristics of ACSL3 that can inform strategy for therapeutic intervention in diseases associated with dysregulated lipid metabolism.











