Cat: PA1000-3230

Recombinant Human TNFRSF11A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF11A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFRSF11A;RANK;Tumor necrosis factor receptor superfamily member 11A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y6Q6

  • Expression Region

    30-212aa

  • AA Sequence

    IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP

  • Molecular Weight

    50.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFRSF11A, also known as Receptor Activator of Nuclear Factor-κB (RANK), is a critical member of the tumor necrosis factor receptor superfamily that plays a pivotal role in bone metabolism, immune system regulation, and cell survival. It primarily mediates osteoclastogenesis and is essential for maintaining bone homeostasis. Dysregulation of RANK signaling has been implicated in various pathological conditions, including osteoporosis, rheumatoid arthritis, and certain cancers. Consequently, the therapeutic modulation of RANK signaling has garnered considerable attention in the field of drug development. Research involving recombinant TNFRSF11A proteins aims to elucidate the mechanisms of RANK signaling and its interactions with ligands such as RANKL (RANK Ligand) and OPG (Osteoprotegerin). These studies are crucial for understanding how RANK functions at the molecular level and for developing targeted therapies that could inhibit or enhance RANK activity in disease contexts. Furthermore, recombinant RANK proteins serve as valuable tools for examining the receptor’s structure-function relationships and for screening potential inhibitors or agonists, fostering advancements in treatment strategies for bone-related diseases and malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US