Analytical Data
-
Gene name
TNFSF1
- Application
-
Alternative Names
TNFSF1;TNFB;Lymphotoxin-alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01374
-
Expression Region
35-205aa
-
AA Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
-
Molecular Weight
20.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF1, also known as tumor necrosis factor ligand superfamily member 1, is a crucial protein involved in the regulation of immune responses and inflammation. It belongs to a broader family of tumor necrosis factor (TNF) ligands, which play significant roles in cell signaling, apoptosis, and the modulation of immune cells. Research on TNFSF1 is driven by its potential therapeutic applications, particularly in autoimmune diseases, cancer, and inflammatory disorders. Understanding the molecular mechanisms underlying the interaction of TNFSF1 with its receptors can lead to the development of novel therapeutic strategies and biologics that can enhance or inhibit immune responses. Recent studies have focused on the recombinant expression of TNFSF1 to investigate its structure-function relationship, elucidate its biological activities, and evaluate its potential as a drug candidate. By producing and characterizing recombinant TNFSF1, researchers aim to explore its role in promoting apoptosis in cancer cells, modulating T-cell responses, and providing insights into its therapeutic efficacy. This ongoing research holds promise for advancing our understanding of immune regulation and developing targeted therapies for various diseases.











