Analytical Data
-
Gene name
ORF1-FL49
- Application
-
Alternative Names
Cysteine-rich and transmembrane domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1C7
-
Expression Region
1-97 aa
-
AA Sequence
MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT
-
Molecular Weight
36.41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ORF1-FL49 recombinant protein is a product of significant interest due to its potential implications in understanding various biological processes, particularly in the study of viral mechanisms and host interactions. ORF1, derived from certain viral genomes, encodes non-structural proteins that play critical roles in viral replication and transcription. The FL49 region is associated with specific functional characteristics that may influence the viral life cycle and pathogenicity. Research into ORF1-FL49 recombinant protein allows scientists to explore its biochemical properties, cellular interactions, and potential applications, such as the development of novel antiviral strategies and therapeutic interventions. Moreover, the study of this recombinant protein contributes to a broader understanding of viral evolution and host defense mechanisms, which is vital for the advancement of molecular biology and virology. By dissecting its structure and function, researchers aim to unveil the underlying principles of viral biology, providing insights that can lead to improved disease management and prevention approaches. As such, the investigation of ORF1-FL49 is not only a pursuit of academic interest but also holds promise for significant contributions to public health and biotechnology.
