Analytical Data
-
Gene name
OR9G1
- Application
-
Alternative Names
OR9G1; OR9G5; Olfactory receptor 9G1; Olfactory receptor 9G5; Olfactory receptor OR11-114
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH87
-
Expression Region
1-305 aa
-
AA Sequence
MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSCLHTPMYF FTGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLCQFFFSAGLAYSECYLLAAVAYD RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCRENIIDDFFCDL LPLVELACGEKGGYKIMMYFLLASNVICPAVLILASYLFIITSVLRISSSKGYLKAFSTC SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEAL KKLLP
-
Molecular Weight
34.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR9G1 is a member of the olfactory receptor family, which plays a crucial role in the sensory perception of odors. Research into OR9G1 has gained traction due to its potential implications in understanding the mechanisms of olfactory signaling and its broader effects on behavior and cognition. The olfactory system comprises a vast array of receptors, and OR9G1 is particularly interesting because of its unique expression patterns and potential interactions with various odorant molecules. Studies have suggested that OR9G1 may be involved in the detection of specific volatile compounds, which can influence emotional responses and social behavior. Given the complexity of olfactory signaling, the exploration of OR9G1 as a recombinant protein offers valuable insights into receptor interactions and downstream signaling pathways. By producing and studying OR9G1 in a controlled laboratory setting, researchers aim to elucidate its functional properties and how it integrates into the larger olfactory network. This research may also have implications for understanding olfactory-related disorders and developing therapeutic strategies that target olfactory pathways. Overall, the investigation of OR9G1 as a recombinant protein highlights the importance of olfactory receptors in sensory biology and their potential impact on human health and behavior.
