Analytical Data
-
Gene name
OR8H1
- Application
-
Alternative Names
OR8H1; Olfactory receptor 8H1; Olfactory receptor OR11-180
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGG4
-
Expression Region
1-311 aa
-
AA Sequence
MGRRNNTNVPDFILTGLSDSEEVQMALFILFLLIYLITMLGNVGMILIIRLDLQLHTPMY FFLTHLSFIDLSYSTVITPKTLANLLTSNYISFMGCFAQMFFFVFLGAAECFLLSSMAYD RYVAICSPLRYPVIMSKRLCCALVTGPYVISFINSFVNVVWMSRLHFCDSNVVRHFFCDT SPILALSCMDTYDIEIMIHILAGSTLMVSLITISASYVSILSTILKINSTSGKQKALSTC ASHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL IRVMQRRQDSR
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR8H1 protein, a member of the olfactory receptor family, is primarily expressed in the human olfactory epithelium and plays a crucial role in scent perception. Research into OR8H1 focuses on its structure, functional mechanisms, and potential implications in human behavior and health. With approximately 400 functional olfactory receptor genes encoded in the human genome, understanding OR8H1 can provide insights into the molecular basis of olfaction and its variations among individuals. Furthermore, olfactory receptors like OR8H1 have been implicated in other physiological processes, including immune response and even tumor biology. Recent studies have utilized recombinant DNA technology to produce the OR8H1 protein for in vitro analysis, enabling researchers to investigate its ligand-binding properties and signal transduction pathways. The exploration of OR8H1 and its interactions with various odorants may uncover the receptor's specific roles in sensory processing and its potential links to neurological disorders or affective conditions. By advancing our understanding of OR8H1, researchers aim to contribute to the broader knowledge of receptor biology, olfactory system function, and the development of therapeutic strategies targeting olfactory-related disorders.
