Analytical Data
-
Gene name
OR7A17
- Application
-
Alternative Names
OR7A17; Olfactory receptor 7A17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14581
-
Expression Region
1-309 aa
-
AA Sequence
MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAY DRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCE LNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFST CASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRA LKMSFRGKQ
-
Molecular Weight
34.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR7A17 protein, a variant of the olfactory receptor family, plays a significant role in the human sense of smell, specifically in detecting a variety of odorant molecules. Given the complexity of olfactory receptors and their involvement in various physiological processes, research on OR7A17 has gained traction. Previous studies indicate that this receptor may be implicated in specific olfactory signaling pathways, influencing behavioral responses to odorants. Understanding the structure and function of OR7A17 is critical not only for elucidating its precise role in olfaction but also for exploring its potential connections to broader biological systems and disorders related to sensory perception. Additionally, as a model for studying receptor signaling mechanisms, OR7A17 presents opportunities for drug discovery, potentially leading to therapeutic innovations aimed at treating conditions arising from sensory dysfunction. Thus, the recombinant production and functional characterization of OR7A17 are essential for advancing our understanding of olfactory biology and its implications for human health.
