Analytical Data
-
Gene name
OR6Y1
- Application
-
Alternative Names
OR6Y1; OR6Y2; Olfactory receptor 6Y1; Olfactory receptor 6Y2; Olfactory receptor OR1-11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGX8
-
Expression Region
1-325 aa
-
AA Sequence
MTTIILEVDNHTVTTRFILLGFPTRPAFQLLFFSIFLATYLLTLLENLLIILAIHSDGQL HKPMYFFLSHLSFLEMWYVTVISPKMLVDFLSHDKSISFNGCMTQLYFFVTFVCTEYILL AIMAFDRYVAICNPLRYPVIMTNQLCGTLAGGCWFCGLMTAMIKMVFIAQLHYCGMPQIN HYFCDISPLLNVSCEDASQAEMVDFFLALMVIAIPLCVVVASYAAILATILRIPSAQGRQ KAFSTCASHLTVVILFYSMTLFTYARPKLMYAYNSNKVVSVLYTVIVPLLNPIIYCLRNH EVKAALRKTIHCRGSGPQGNGAFSS
-
Molecular Weight
36.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR6Y1 protein, a member of the olfactory receptor family, has garnered increasing attention in recent years due to its potential roles in odor detection and signal transduction. This receptor, primarily expressed in the olfactory epithelium, is part of a large family of G-protein-coupled receptors that play crucial roles in the sensory perception of smell. Research has suggested that OR6Y1 may be involved in detecting specific odorant compounds, which could contribute to individual variations in olfactory responses and preferences. Given its unique expression patterns and functional characteristics, OR6Y1 has become a target of investigation in both sensory biology and neurobiology, as understanding its mechanisms may provide insights into the complexities of the olfactory system. Moreover, studies focusing on the recombinant expression of OR6Y1 proteins have been instrumental in elucidating their structural and functional properties, allowing researchers to explore potential applications in flavor and fragrance industries, as well as in the development of novel therapeutic strategies for olfactory dysfunction. Overall, the ongoing research surrounding OR6Y1 reinforces its significance in understanding the molecular basis of olfaction and highlights the need for further exploration of its biological implications in both health and disease contexts.
