Analytical Data
-
Gene name
OR6C4
- Application
-
Alternative Names
OR6C4; Olfactory receptor 6C4; Olfactory receptor OR12-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGE1
-
Expression Region
1-309 aa
-
AA Sequence
MKNRTMFGEFILLGLTNQPELQVMIFIFLFLTYMLSILGNLTIITLTLLDPHLQTPMYFF LRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEFYLLASMSYDR YVAICKPLHYLTIMSSRVCIQLVFCSWLGGFLAILPPIILMTQVDFCVSNILNHYYCDYG PLVELACSDTSLLELMVILLAVVTLMVTLVLVTLSYTYIIRTILRIPSAQQRTKAFSTCS SHMIVISLSYGSCMFMYINPSAKEGGAFNKGIAVLITSVTPLLNPFIYTLRNQQVKQAFK DSVKKIVKL
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6C4 is a member of the olfactory receptor family, specifically classified within the class of G-protein-coupled receptors (GPCRs), which are crucial for sensory perception, particularly in the detection of odorants. The study of OR6C4 is significant due to its role in the olfactory system and potential implications for understanding how mammals perceive their environment. Despite the extensive knowledge on the olfactory receptor genes, OR6C4 remains largely underexplored. Research on recombinant OR6C4 proteins aims to elucidate its structure-function relationship, signaling pathways, and ligand interactions. These studies could provide insights into the specific odorants that OR6C4 is sensitive to and its contribution to the overall sensory landscape of olfaction. Furthermore, understanding OR6C4’s mechanisms may have implications in fields such as neurobiology, pharmacology, and the development of artificial olfaction systems. Overall, ongoing research into OR6C4 could shed light on the complexities of olfactory signaling and broaden our knowledge of sensory biology.
