Analytical Data
-
Gene name
OR6B3
- Application
-
Alternative Names
OR6B3; OR6B3P; Olfactory receptor 6B3; Olfactory receptor OR2-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGW1
-
Expression Region
1-331 aa
-
AA Sequence
MSGENVTRVGTFILVGFPTAPGLQYLLFLLFLLTYLFVLVENLAIILTVWSSTSLHRPMY YFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAY DRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCD ISPILKLACTDFSTAELVDFILAFIILVFPLLATMLSYAHITLAVLRIPSATGCWRAFFT CASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISVLYTVITPILNPLIYCLRNKEFKNA LKKAFGLTSCAVEGRLSSLLELHLQIHSQPL
-
Molecular Weight
37.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6B3, a member of the olfactory receptor gene family, has garnered significant interest in the field of molecular biology and neuroscience due to its unique role in the olfactory system. Olfactory receptors are critical for the detection of odorants and play a pivotal role in the sense of smell, which is essential for various biological processes, including mating, foraging, and predator avoidance. OR6B3, in particular, has been implicated in the recognition of specific odorant molecules, which is vital for understanding the molecular mechanisms underlying olfactory perception. Recent studies have indicated that variations in OR6B3 may be linked to differences in odor sensitivity among individuals, raising questions about the genetic basis of olfactory function. Furthermore, research into the recombinant expression of OR6B3 protein enables the characterization of its functional properties and interactions with odorants, thereby providing insights into the structural requirements for receptor activation. These studies not only contribute to the understanding of olfactory signaling pathways but also have potential implications in the fields of fragrance development, flavor enhancement, and even disease prediction related to olfactory dysfunction. Continued exploration of OR6B3 and its recombinant protein could lead to breakthroughs in both basic science and practical applications, making it a focal point for future research endeavors in sensory biology.
