Analytical Data
-
Gene name
TCEA2
- Application
-
Alternative Names
TCEA2；Transcription elongation factor A Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15560
-
Expression Region
1-299aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMMGKEEEIARIARRLDKMVTKKSAEGA MDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAKSLIKSWK KLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITT FPPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRD VGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMA SDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTR SSDEPMTTFVVCNECGNRWKFC
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TCEA2, or Transcription Elongation Factor A (SII), is a crucial protein involved in the regulation of RNA polymerase II transcription elongation. Research into TCEA2 has gained importance due to its role in the transcriptional machinery, where it influences mRNA synthesis and processing. Dysregulation of TCEA2 has been implicated in various cellular processes, including cell proliferation and differentiation, making it a potential target for understanding diseases such as cancer. Recent studies have focused on the characterization and recombinant expression of TCEA2 to explore its functional mechanisms and interactions with other transcription factors. The ability to produce TCEA2 as a recombinant protein enables researchers to examine its structural properties, post-translational modifications, and binding affinities, which are critical for elucidating its role in transcription regulation. Moreover, understanding the functional dynamics of TCEA2 could provide insights into therapeutic strategies aimed at modulating gene expression in pathological conditions. As a result, the ongoing investigation into the biochemical and biological properties of TCEA2 is pivotal for expanding our knowledge of gene regulation and the development of targeted interventions in diseases associated with transcriptional dysregulation.
