Analytical Data
-
Gene name
OR52E4
- Application
-
Alternative Names
OR52E4; Olfactory receptor 52E4; Olfactory receptor OR11-55
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGH9
-
Expression Region
1-312 aa
-
AA Sequence
MPSINDTHFYPPFFLLLGIPGLDTLHIWISFPFCIVYLIAIVGNMTILFVIKTEHSLHQP MFYFLAMLSMIDLGLSTSTIPKMLGIFWFNLQEISFGGCLLQMFFIHMFTGMETVLLVVM AYDRFVAICNPLQYTMILTNKTISILASVVVGRNLVLVTPFVFLILRLPFCGHNIVPHTY CEHRGLAGLACAPIKINIIYGLMVISYIIVDVILIASSYVLILRAVFRLPSQDVRLKAFN TCGSHVCVMLCFYTPAFFSFMTHRFGQNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI REQIVKIFVQKE
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR52E4 protein, part of the olfactory receptor family, has garnered significant interest in recent years due to its intriguing role in the sense of smell and potential implications in human health. Olfactory receptors (ORs) are G protein-coupled receptors (GPCRs) that facilitate the recognition of a wide array of odorant molecules, contributing to the understanding of pheromonal signaling and sensory perception. OR52E4, in particular, has been implicated in the detection of specific odorants and may play a role in neurobiology and behavior. Studies have suggested that variations in OR52E4 expression could be linked to olfactory dysfunctions, which are often associated with neurological conditions and age-related sensory decline. Furthermore, the potential for OR52E4 to serve as a biomarker in diseases such as Alzheimer's and Parkinson's disease has opened avenues for research into novel diagnostic and therapeutic strategies. Insights into the molecular mechanisms of OR52E4 signaling and activation may pave the way for developing new approaches in sensory biology and personalized medicine. Understanding its structure and function also holds promise for advancing biotechnological applications, including the development of odor-based sensors and flavor enhancement in the food industry. Overall, the study of OR52E4 is positioned at the intersection of sensory biology, neurobiology, and therapeutic research, highlighting its significance in both fundamental science and practical applications in health and disease.











