Cat: PA2000-9966

Recombinant Human OR52E2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR52E2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR52E2; Olfactory receptor 52E2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGJ4

  • Expression Region

    1-325 aa

  • AA Sequence

    MFLPNDTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYMIALIGNFTILLVIKTDSSLHQP MFYFLAMLATTDVGLSTATIPKMLGIFWINLRGIIFEACLTQMFFIHNFTLMESAVLVAM AYDSYVAICNPLQYSAILTNKVVSVIGLGVFVRALIFVIPSILLILRLPFCGNHVIPHTY CEHMGLAHLSCASIKINIIYGLCAICNLVFDITVIALSYVHILCAVFRLPTHEARLKSLS TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI YKCVKKILLQEQGMEKEEYLIHTRF

  • Molecular Weight

    36.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR52E2 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of odorants in the nasal epithelium. The research surrounding OR52E2 has gained attention due to its potential implications in understanding olfactory signaling and its association with various physiological and pathological conditions. Studies have indicated that this receptor may be involved in important biological processes beyond the sense of smell, including its potential role in cancer progression, neurodegenerative diseases, and various metabolic disorders. The unique expression pattern of OR52E2 in specific tissues suggests that it may have specialized functions that warrant further investigation. Furthermore, as researchers gain insights into the mechanisms of odorant recognition and signal transduction facilitated by OR52E2, there are hopes that these findings could lead to novel therapeutic strategies. The ability to recombinantly express OR52E2 protein opens new avenues for structural and functional studies, allowing scientists to explore its binding properties and cellular responses in a controlled environment. Understanding OR52E2 at a molecular level could enhance our comprehension of olfactory pathways and lead to advancements in medical science, particularly in areas related to sensory perception and disorders linked to the olfactory system. Overall, the exploration of OR52E2 as a recombinant protein serves as a critical step toward unveiling its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US