Analytical Data
-
Gene name
OR52E2
- Application
-
Alternative Names
OR52E2; Olfactory receptor 52E2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGJ4
-
Expression Region
1-325 aa
-
AA Sequence
MFLPNDTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYMIALIGNFTILLVIKTDSSLHQP MFYFLAMLATTDVGLSTATIPKMLGIFWINLRGIIFEACLTQMFFIHNFTLMESAVLVAM AYDSYVAICNPLQYSAILTNKVVSVIGLGVFVRALIFVIPSILLILRLPFCGNHVIPHTY CEHMGLAHLSCASIKINIIYGLCAICNLVFDITVIALSYVHILCAVFRLPTHEARLKSLS TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI YKCVKKILLQEQGMEKEEYLIHTRF
-
Molecular Weight
36.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52E2 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of odorants in the nasal epithelium. The research surrounding OR52E2 has gained attention due to its potential implications in understanding olfactory signaling and its association with various physiological and pathological conditions. Studies have indicated that this receptor may be involved in important biological processes beyond the sense of smell, including its potential role in cancer progression, neurodegenerative diseases, and various metabolic disorders. The unique expression pattern of OR52E2 in specific tissues suggests that it may have specialized functions that warrant further investigation. Furthermore, as researchers gain insights into the mechanisms of odorant recognition and signal transduction facilitated by OR52E2, there are hopes that these findings could lead to novel therapeutic strategies. The ability to recombinantly express OR52E2 protein opens new avenues for structural and functional studies, allowing scientists to explore its binding properties and cellular responses in a controlled environment. Understanding OR52E2 at a molecular level could enhance our comprehension of olfactory pathways and lead to advancements in medical science, particularly in areas related to sensory perception and disorders linked to the olfactory system. Overall, the exploration of OR52E2 as a recombinant protein serves as a critical step toward unveiling its biological significance and therapeutic potential.











