Cat: PA2000-9964

Recombinant Human OR52B6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR52B6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR52B6; Olfactory receptor 52B6; Olfactory receptor OR11-47

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGF0

  • Expression Region

    1-335 aa

  • AA Sequence

    MAQVRALHKIMALFSANSIGAMNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALE GNGILICVILSQAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQ MFFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIF LLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHI LQAVFRLLSQDARSKALSTCGSHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLY VVIPPMLNPVIYGVRTKPILEGAKQMFSNLAKGSK

  • Molecular Weight

    36.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR52B6 is a member of the olfactory receptor (OR) family, which plays a crucial role in the sense of smell. Research into OR52B6 and its recombinant protein is primarily driven by the growing interest in understanding the mechanisms of olfactory signaling and its implications for various biological processes. Olfactory receptors are integral membrane proteins that can function as chemosensors, detecting a wide range of odorant molecules. The study of OR52B6 is particularly compelling due to its potential role in mediating responses to odorants related to human health and disease. Additionally, understanding the structure and function of OR52B6 may unlock new therapeutic avenues for conditions linked to the olfactory system, such as anosmia or neurological disorders. The generation of recombinant OR52B6 proteins allows for detailed investigations into their binding affinities, signaling pathways, and interactions with other cellular components. This research not only contributes to the fundamental knowledge of sensory biology but also holds promise for applications in biotechnology and pharmacology, where olfactory receptors can be utilized as biosensors or targets for drug development. As such, the study of OR52B6 represents a significant intersection of molecular biology, neuroscience, and medical research, paving the way for innovative approaches to leverage the senses in therapeutic contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US