Analytical Data
-
Gene name
OR52B6
- Application
-
Alternative Names
OR52B6; Olfactory receptor 52B6; Olfactory receptor OR11-47
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGF0
-
Expression Region
1-335 aa
-
AA Sequence
MAQVRALHKIMALFSANSIGAMNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALE GNGILICVILSQAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQ MFFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIF LLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHI LQAVFRLLSQDARSKALSTCGSHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLY VVIPPMLNPVIYGVRTKPILEGAKQMFSNLAKGSK
-
Molecular Weight
36.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52B6 is a member of the olfactory receptor (OR) family, which plays a crucial role in the sense of smell. Research into OR52B6 and its recombinant protein is primarily driven by the growing interest in understanding the mechanisms of olfactory signaling and its implications for various biological processes. Olfactory receptors are integral membrane proteins that can function as chemosensors, detecting a wide range of odorant molecules. The study of OR52B6 is particularly compelling due to its potential role in mediating responses to odorants related to human health and disease. Additionally, understanding the structure and function of OR52B6 may unlock new therapeutic avenues for conditions linked to the olfactory system, such as anosmia or neurological disorders. The generation of recombinant OR52B6 proteins allows for detailed investigations into their binding affinities, signaling pathways, and interactions with other cellular components. This research not only contributes to the fundamental knowledge of sensory biology but also holds promise for applications in biotechnology and pharmacology, where olfactory receptors can be utilized as biosensors or targets for drug development. As such, the study of OR52B6 represents a significant intersection of molecular biology, neuroscience, and medical research, paving the way for innovative approaches to leverage the senses in therapeutic contexts.
