Analytical Data
-
Gene name
OR52B2
- Application
-
Alternative Names
OR52B2; Olfactory receptor 52B2; Olfactory receptor OR11-70
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RD2
-
Expression Region
1-323 aa
-
AA Sequence
MSHTNVTIFHPAVFVLPGIPGLEAYHIWLSIPLCLIYITAVLGNSILIVVIVMERNLHVP MYFFLSMLAVMDILLSTTTVPKALAIFWLQAHNIAFDACVTQGFFVHMMFVGESAILLAM AFDRFVAICAPLRYTTVLTWPVVGRIALAVITRSFCIIFPVIFLLKRLPFCLTNIVPHSY CEHIGVARLACADITVNIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKAL STCGSHLCVILMFYVPSFFTLLTHHFGRNIPQHVHILLANLYVAVPPMLNPIVYGVKTKQ IREGVAHRFFDIKTWCCTSPLGS
-
Molecular Weight
36.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52B2 is a member of the olfactory receptor (OR) family, which plays a crucial role in the sensory perception of smell. Research on OR52B2 has gained interest due to its potential implications in various physiological and pathological processes, including chemosensory functions, neural signaling, and even cancer biology. Unlike the well-studied classical receptors, OR52B2 and its signaling pathways remain relatively underexplored. Preliminary studies suggest that OR52B2 might be involved in the modulation of immune responses and the regulation of cell proliferation, indicating its broader significance beyond just olfaction. The recombinant expression of OR52B2 offers an opportunity to investigate its functional properties in vitro, enabling researchers to dissect its interactions with various ligands and to evaluate its role in cellular signaling pathways. Moreover, understanding the structure-function relationships of OR52B2 through recombinant protein studies could provide insights into the development of novel therapeutic strategies for diseases where olfactory signaling is disrupted. Distinguishing the specific ligand-receptor dynamics of OR52B2 may also reveal new avenues for drug discovery, especially in targeting cancerous tissues that exploit similar signaling mechanisms. Thus, the study of OR52B2 as a recombinant protein not only furthers our comprehension of olfactory receptors but also sets the stage for potential biomedical applications in treating diverse diseases linked to its activity.











