Cat: PA2000-9963

Recombinant Human OR52B2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR52B2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR52B2; Olfactory receptor 52B2; Olfactory receptor OR11-70

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96RD2

  • Expression Region

    1-323 aa

  • AA Sequence

    MSHTNVTIFHPAVFVLPGIPGLEAYHIWLSIPLCLIYITAVLGNSILIVVIVMERNLHVP MYFFLSMLAVMDILLSTTTVPKALAIFWLQAHNIAFDACVTQGFFVHMMFVGESAILLAM AFDRFVAICAPLRYTTVLTWPVVGRIALAVITRSFCIIFPVIFLLKRLPFCLTNIVPHSY CEHIGVARLACADITVNIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKAL STCGSHLCVILMFYVPSFFTLLTHHFGRNIPQHVHILLANLYVAVPPMLNPIVYGVKTKQ IREGVAHRFFDIKTWCCTSPLGS

  • Molecular Weight

    36.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR52B2 is a member of the olfactory receptor (OR) family, which plays a crucial role in the sensory perception of smell. Research on OR52B2 has gained interest due to its potential implications in various physiological and pathological processes, including chemosensory functions, neural signaling, and even cancer biology. Unlike the well-studied classical receptors, OR52B2 and its signaling pathways remain relatively underexplored. Preliminary studies suggest that OR52B2 might be involved in the modulation of immune responses and the regulation of cell proliferation, indicating its broader significance beyond just olfaction. The recombinant expression of OR52B2 offers an opportunity to investigate its functional properties in vitro, enabling researchers to dissect its interactions with various ligands and to evaluate its role in cellular signaling pathways. Moreover, understanding the structure-function relationships of OR52B2 through recombinant protein studies could provide insights into the development of novel therapeutic strategies for diseases where olfactory signaling is disrupted. Distinguishing the specific ligand-receptor dynamics of OR52B2 may also reveal new avenues for drug discovery, especially in targeting cancerous tissues that exploit similar signaling mechanisms. Thus, the study of OR52B2 as a recombinant protein not only furthers our comprehension of olfactory receptors but also sets the stage for potential biomedical applications in treating diverse diseases linked to its activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US