Analytical Data
-
Gene name
OR4S2
- Application
-
Alternative Names
OR4S2; OR4S2P; Olfactory receptor 4S2; Olfactory receptor OR11-137
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH73
-
Expression Region
1-311 aa
-
AA Sequence
MEKINNVTEFIFWGLSQSPEIEKVCFVVFSFFYIIILLGNLLIMLTVCLSNLFKSPMYFF LSFLSFVDICYSSVTAPKMIVDLLAKDKTISYVGCMLQLFGVHFFGCTEIFILTVMAYDR YVAICKPLHYMTIMNRETCNKMLLGTWVGGFLHSIIQVALVVQLPFCGPNEIDHYFCDVH PVLKLACTETYIVGVVVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGS HIAMVVIFFGPCTFMYMRPDTTFSEDKMVAVFYTIITPMLNPLIYTLRNAEVKNAMKKLW GRNVFLEAKGK
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4S2 is a member of the olfactory receptor (OR) family, specifically categorized as a type of G protein-coupled receptor (GPCR). These receptors play a crucial role in the sensory perception of odors, and their function is essential for various biological and behavioral processes in vertebrates. The research on OR4S2 has emerged from a broader interest in understanding how olfactory signaling pathways contribute to the detection and interpretation of environmental cues. Recent studies have indicated that OR4S2 may be involved in the recognition of specific odorant molecules, potentially influencing behavioral responses such as foraging and mating strategies. Additionally, the study of OR4S2 and its interactions with other molecular partners may provide insights into the evolutionary biology of the olfactory system, as well as its implications in neurobiology and sensory processing. Furthermore, exploring the structural and functional characteristics of OR4S2 can pave the way for advancements in biotechnological applications, such as the development of novel biosensors or therapeutic targets for olfactory dysfunction. Overall, the investigation of OR4S2 and related receptors has significant implications for our understanding of sensory biology and the complex interplay between organisms and their environment.
