Analytical Data
-
Gene name
OR4P4
- Application
-
Alternative Names
OR4P4; OR4P3P; Olfactory receptor 4P4; Olfactory receptor 4P3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGL7
-
Expression Region
1-312 aa
-
AA Sequence
MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFF LNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDR YVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVY PLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSKALATCSS HVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVW CCQILLKRNQLF
-
Molecular Weight
35.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR4P4 protein, part of the olfactory receptor gene family, is a G-protein-coupled receptor (GPCR) primarily expressed in the human olfactory system. Olfactory receptors play a crucial role in the detection of volatile chemical substances, contributing to the sense of smell. Despite belonging to a large and diverse family of receptors, OR4P4 has garnered attention for its unique expression pattern and potential roles beyond olfaction. Recent research has indicated that some olfactory receptors may influence various physiological processes, including immune response and mood regulation. The study of OR4P4, particularly its structure and function, offers insights into the intricate mechanisms of sensory perception and may have implications for understanding certain neurological disorders. Investigating the recombinant form of OR4P4 allows researchers to explore its ligand-binding properties and signaling pathways, which could lead to novel applications in therapeutics or biomarker development. Given the increasing recognition of the importance of GPCRs in cellular communication and their role as drug targets, research into OR4P4 and similar receptors is both timely and essential for expanding our knowledge of sensory biology and its broader implications in human health.
