Analytical Data
-
Gene name
OR4M2
- Application
-
Alternative Names
OR4M2; Olfactory receptor 4M2; Olfactory receptor OR15-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGB6
-
Expression Region
1-313 aa
-
AA Sequence
METANYTKVTEFVLTGLSQTPEVQLVLFVIFLSFYLFILPGNILIICTISLDPHLTSPMY FLLANLAFLDIWYSSITAPEMLIDFFVERKIISFDGCIAQLFFLHFAGASEMFLLTVMAF DLYTAICRPLHYATIMNQRLCCILVALSWRGGFIHSIIQVALIVRLPFCGPNELDSYFCD ITQVVRIACANTFPEELVMICSSGLISVVCLIALLMSYAFLLALFKKLSGSGENTNRAMS TCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFNTLIFPLRNPIIYTLRNKEVKAAM RKLVTKYILCKEK
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4M2 is a member of the olfactory receptor gene family, which has garnered interest due to its unique role in the sensory perception of smell and its potential implications in various biological processes. Unlike many other olfactory receptors, the specific function of OR4M2 is not entirely understood, making it a compelling target for research. Studies have indicated that olfactory receptors, including OR4M2, may influence not only traditional sensory functions but also play roles in non-sensory biological activities, such as the modulation of cell signaling pathways and interaction with immune responses. The investigation of OR4M2's structure and function can provide insights into the mechanisms underlying olfactory signaling and the molecular basis of odorant recognition. Furthermore, understanding OR4M2's role could elucidate its involvement in physiological and pathophysiological conditions, including its potential association with neurodegenerative diseases where olfactory dysfunction is a common early symptom. Given these factors, the research on OR4M2 recombinant proteins aims to characterize their expression, signaling pathways, and potential interactions with ligands, thereby contributing to a broader understanding of olfactory mechanisms and their implications for health and disease.











