Analytical Data
-
Gene name
OR4K5
- Application
-
Alternative Names
OR4K5; Olfactory receptor 4K5; Olfactory receptor OR14-16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGD3
-
Expression Region
1-323 aa
-
AA Sequence
MDKSNSSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMY FLLGNLSFVDICQASFATPKMIADFLSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAY DRYVAICKPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCD LPRVTKLACLDSYIIEILIVVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTL ASHIAVVILFFGPCIFIYVWPFTISPLDKFLAIFYTVFTPVLNPIIYTLRNRDMKAAVRK IVNHYLRPRRISEMSLVVRTSFH
-
Molecular Weight
36.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4K5, a member of the olfactory receptor gene family, has garnered attention in recent years due to its potential roles in pharmacology, neuroscience, and chemosensory function. Olfactory receptors, primarily known for their function in the detection of odorants, are G-protein-coupled receptors (GPCRs) that can also act as versatile signaling molecules in various biological processes. The study of OR4K5 is particularly significant as it is expressed in non-olfactory tissues, suggesting additional roles beyond olfaction, including possible implications in inflammation and neurodevelopment. Despite being less studied than other olfactory receptors, advances in molecular biology and recombinant protein technology have enabled researchers to explore the structure and function of OR4K5 in detail. The generation of recombinant OR4K5 proteins allows for functional assays and structural characterization, which are essential for understanding its mechanisms of action and interactions with ligands. Additionally, the exploration of OR4K5's signaling pathways could provide insights into novel therapeutic targets for various diseases, highlighting the importance of this receptor in both basic and applied research. Overall, the investigation of OR4K5 contributes to the broader understanding of GPCRs and their diverse physiological roles, paving the way for future studies that may uncover its significance in health and disease.
