Analytical Data
-
Gene name
SULT2A1
- Application
-
Alternative Names
SULT2A1；HST；Sulfotransferase 2A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06520
-
Expression Region
1-285aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFRSETLRKVRDEF VIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVES EIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSG YFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSN YSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE LFPWE
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT2A1 (Sulfotransferase 2A1) is a significant member of the sulfotransferase enzyme family, primarily involved in the metabolism of steroid hormones, particularly androgens and estrogens. Understanding the function of SULT2A1 is crucial as it plays a pivotal role in regulating steroid availability and activity in tissues, influencing various physiological processes including reproductive health, adrenal function, and potentially the pathogenesis of hormone-related diseases such as breast and prostate cancer. Research into SULT2A1 has gained momentum due to its implications in drug metabolism and toxicology, as it catalyzes the sulfonation of a variety of xenobiotic compounds. Recombinant SULT2A1 protein has been generated to facilitate detailed studies on its enzymatic activity, substrate specificity, and structure-function relationships. This recombinant protein allows researchers to investigate the enzyme's role in steroid hormone biosynthesis and detoxification pathways in vitro and to explore its interactions with pharmaceutical compounds. Furthermore, understanding the genetic polymorphisms and regulatory mechanisms of SULT2A1 can provide insights into individual variations in drug response and susceptibility to diseases associated with hormonal imbalances. Overall, the research on recombinant SULT2A1 protein is essential for elucidating its biological functions and potential therapeutic applications in the context of endocrine health and disease.
