Analytical Data
-
Gene name
OR4K14
- Application
-
Alternative Names
OR4K14; Olfactory receptor 4K14; Olfactory receptor OR14-22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGD5
-
Expression Region
1-310 aa
-
AA Sequence
MDPQNYSLVSEFVLHGLCTSRHLQNFFFIFFFGVYVAIMLGNLLILVTVISDPCLHSSPM YFLLGNLAFLDMWLASFATPKMIRDFLSDQKLISFGGCMAQIFFLHFTGGAEMVLLVSMA YDRYVAICKPLHYMTLMSWQTCIRLVLASWVVGFVHSISQVAFTVNLPYCGPNEVDSFFC DLPLVIKLACMDTYVLGIIMISDSGLLSLSCFLLLLISYTVILLAIRQRAAGSTSKALST CSAHIMVVTLFFGPCIFVYVRPFSRFSVDKLLSVFYTIFTPLLNPIIYTLRNEEMKAAMK KLQNRRVTFQ
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4K14 is a member of the olfactory receptor (OR) family, which plays a crucial role in the sensory perception of odors. The study of OR4K14 and its recombinant protein is significant due to its potential implications in understanding olfactory mechanisms and their influence on behaviors such as attraction and aversion. Despite the vast array of olfactory receptors identified, the functionality and specific ligand interactions of many remain poorly characterized. OR4K14, like other ORs, is expressed in the olfactory epithelium and has been linked to various physiological processes, including neurogenesis and cellular signaling. Research into OR4K14's recombinant protein will enable the investigation of its structure-function relationship and ligand-binding properties. Additionally, understanding OR4K14 can contribute to the development of novel biosensors or therapeutic strategies for olfactory dysfunctions and related disorders. By examining the biophysical and biochemical characteristics of OR4K14, as well as its interaction with various odorant molecules, scientists aim to shed light on its role in the broader olfactory receptor network. Overall, the exploration of OR4K14's recombinant protein highlights the importance of this olfactory receptor in sensory biology and its potential applications in biotechnology and medicine.











