Analytical Data
-
Gene name
OR4K13
- Application
-
Alternative Names
OR4K13; Olfactory receptor 4K13; Olfactory receptor OR14-27
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH42
-
Expression Region
1-304 aa
-
AA Sequence
MERANHSVVSEFILLGLSKSQNLQILFFLGFSVVFVGIVLGNLLILVTVTFDSLLHTPMY FLLSNLSCIDMILASFATPKMIVDFLRERKTISWWGCYSQMFFMHLLGGSEMMLLVAMAI DRYVAICKPLHYMTIMSPRVLTGLLLSSYAVGFVHSSSQMAFMLTLPFCGPNVIDSFFCD LPLVIKLACKDTYILQLLVIADSGLLSLVCFLLLLVSYGVIIFSVRYRAASRSSKAFSTL SAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKK RLCI
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4K13 is a member of the olfactory receptor gene family, specifically categorized under the class of G protein-coupled receptors (GPCRs) that play a crucial role in the sensory perception of odors. Research into OR4K13 has gained attention due to its potential implications in olfactory transduction processes and its relevance in understanding olfactory receptor function. The study of OR4K13 is essential not only for elucidating the molecular mechanisms behind scent detection but also for exploring its involvement in broader physiological processes, including behavior and cognition. Recent advancements in molecular biology techniques and recombinant protein technology have facilitated the expression and purification of OR4K13, enabling researchers to investigate its structural and functional properties in detail. Identifying specific ligands that activate OR4K13 may provide insights into its role in the olfactory system and its potential therapeutic applications, particularly in conditions related to olfactory dysfunction. Furthermore, as the standardization of olfactory receptor research improves, OR4K13 serves as a promising candidate for comparative studies among olfactory receptors, which may enhance our understanding of receptor evolution and diversity across species.
