Analytical Data
-
Gene name
OR4D2
- Application
-
Alternative Names
OR4D2; Olfactory receptor 4D2; B-lymphocyte membrane protein BC2009; Olfactory receptor OR17-24
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58180
-
Expression Region
1-307 aa
-
AA Sequence
METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMY FLLRNLAVLDLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAF DRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCD VPQVLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMSYLFILVMLRSHPGEARRKAASTC TTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTPMLNPMIYTLRNQDMQAAVRR LGRHRLV
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4D2 is a member of the olfactory receptor family, which plays a crucial role in the detection of volatile compounds and odorant signaling. Recent studies have highlighted its potential involvement in various physiological processes beyond olfaction, including immune response and cell signaling. The interest in OR4D2 has surged due to its unique expression patterns in different tissues and its linkage to several diseases. Its role in cancer, for example, has prompted investigations into whether it could serve as a potential biomarker or therapeutic target. Furthermore, the successful production and characterization of recombinant OR4D2 protein are essential for understanding its structure-function relationship and interactions with ligands. This research can provide insights into the molecular mechanics of odorant recognition and contribute to the development of novel pharmacological agents. Overall, the exploration of OR4D2 as a recombinant protein holds promise for advancing our knowledge of olfactory receptors and their broader biological significance.











