Analytical Data
-
Gene name
OR4C15
- Application
-
Alternative Names
OR4C15; Olfactory receptor 4C15; Olfactory receptor OR11-127; Olfactory receptor OR11-134
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGM1
-
Expression Region
1-316 aa
-
AA Sequence
MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYF FLGFLSFLDACFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYD RYVAICKPLHYSSIMNRRLCGILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDL YPLLELACTDTHIFGLMVVINSGFICIINFSLLLVSYAVILLSLRTHSSEGRWKALSTCG SHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPLLNPLIYTFRNKEVKQAMRRI WNRLMVVSDEKENIKL
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4C15 is a member of the olfactory receptor family, which plays a crucial role in the detection of odorants and is involved in the sense of smell. These receptors are G protein-coupled receptors (GPCRs) that are primarily expressed in the olfactory epithelium, but they can also be found in other tissues, indicating potential non-olfactory functions. Despite being one of the many olfactory receptors, OR4C15 has garnered interest due to its unusual expression patterns and potential links to various physiological processes. Research has shown that certain olfactory receptors, including OR4C15, may be involved in modulating immune responses and influencing neurological pathways. The study of OR4C15 recombinant proteins focuses on understanding its structure-function relationships, ligand specificity, and signaling mechanisms. Insights gained from this research may reveal new therapeutic targets for conditions related to olfactory dysfunction, neurobiology, and immune regulation. Due to the vast diversity and complexity of olfactory receptors, the investigation of OR4C15 also contributes to broader studies on GPCRs, offering valuable information on receptor activation, cellular communication, and the molecular basis of sensory perception. Through recombinant protein production and functional assays, researchers aim to elucidate the role of OR4C15 in both olfactory and non-olfactory systems, advancing our knowledge of sensory biology and potential applications in medicine and biotechnology.
