Cat: PA1000-3064

Recombinant Human STX1A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STX1A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STX1A;STX1;Syntaxin-1A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16623

  • Expression Region

    1-265aa

  • AA Sequence

    MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAEN VEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI EQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQ RQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHS EIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD TKKAVKYQSKARRKK

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STX1A (Syntaxin 1A) is a member of the syntaxin family of proteins, which play a crucial role in the process of synaptic vesicle exocytosis, a fundamental mechanism for neurotransmitter release in neuronal communication. The proper functioning of STX1A is essential for the regulation of synaptic transmission, influencing various physiological processes, including learning and memory. Dysregulation or mutations in STX1A have been implicated in several neurological disorders and synaptic dysfunctions, making it a significant target for research. Studies have shown that STX1A interacts with other proteins in the SNARE complex, facilitating the fusion of synaptic vesicles with the presynaptic membrane. The recombinant expression of STX1A protein allows for detailed investigation of its functional properties, structural analysis, and interaction with other molecular partners. Understanding the role of STX1A through recombinant protein studies could provide insights into the molecular mechanisms underlying neuronal signaling and may aid in the development of therapeutic strategies for related neuropsychiatric and neurodegenerative conditions. Overall, research on STX1A recombinant proteins holds promise for enhancing our comprehension of synaptic biology and the intricate pathways of neurotransmission.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US