Analytical Data
-
Gene name
STX2
- Application
-
Alternative Names
STX2；EPIM；Syntaxin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32856
-
Expression Region
1-288aa
-
AA Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STX2 (Syntaxin 2) is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family, which plays a crucial role in membrane trafficking and fusion processes within cells. Research has shown that STX2 is predominantly expressed in various tissues, including the brain, immune system, and epithelial cells, suggesting its involvement in diverse physiological functions. Alterations in STX2 expression have been linked to several diseases, including neurodegenerative disorders and immune dysregulation, highlighting the importance of understanding its molecular mechanisms. The study of STX2 recombinant proteins offers significant insights into its structural characteristics and functional dynamics, facilitating the identification of potential therapeutic targets. Advances in protein engineering techniques allow researchers to produce STX2 variants, which can be used in functional assays to explore its interactions with other SNARE proteins and regulatory molecules. Elucidating the role of STX2 in cellular pathways could provide vital information for developing treatment strategies for conditions associated with its dysregulation. Furthermore, recombinant STX2 could serve as a valuable tool in drug discovery and biomarker development, enhancing our understanding of vesicular transport mechanisms and their implications in health and disease. Therefore, ongoing research focused on STX2 recombinant proteins is essential for unraveling its biological significance and potential clinical applications.
