Analytical Data
-
Gene name
OR4B1
- Application
-
Alternative Names
OR4B1; Olfactory receptor 4B1; OST208; Olfactory receptor OR11-106
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGF8
-
Expression Region
1-309 aa
-
AA Sequence
MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFF LSCLSLVEISYSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDC YVAICKPLHYMNIISRQLCHLLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQ PLFKLACTDTFMEGVIVLANSGLFSVFSFLILVSSYIVILVNLRNHSAEGRHKALSTCAS HITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKIAIRRLW SKKENPGRE
-
Molecular Weight
34.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4B1, a member of the olfactory receptor family, is primarily involved in the perception of scent, playing a crucial role in the olfactory system of various species, including humans. Research on OR4B1 has gained momentum due to its potential implications in understanding the molecular mechanisms of olfaction, as well as its broader significance in pharmacology and disease. Given the critical role that olfactory receptors play in environmental interaction and behavioral responses, the characterization of OR4B1 through recombinant protein techniques has become essential. This involves expressing the receptor in suitable systems to study its structure, function, and signaling pathways. Additionally, OR4B1 has been implicated in various physiological and pathological processes, making it a candidate for exploring therapeutic targets for olfactory dysfunction and other related disorders. Understanding the functional dynamics of OR4B1 can contribute to the development of novel olfactory-based strategies in scent engineering, flavor industries, and even in designing targeted therapies for neurological conditions. Thus, the study of OR4B1 recombinant protein not only enhances our comprehension of sensory biology but also holds promise for translational applications in health and industry.











