Analytical Data
-
Gene name
OR4A47
- Application
-
Alternative Names
OR4A47; Olfactory receptor 4A47; Olfactory receptor OR11-113
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IF82
-
Expression Region
1-309 aa
-
AA Sequence
MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF LAGLSFIDIIYSSSISPRLISGLFFGNNSISFQSCMAQLFIEHIFGGSEVFLLLVMAYDC YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVFQLSIIYGLPFCGPNVIDHFFCDMY PLLKLVCTDTHAIGLLVVANGGLACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSS HMTVVVFFFVPCIFMYARPARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLW RRDLISSST
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4A47, a member of the olfactory receptor family, has garnered attention in recent years due to its potential role in olfaction and its implications in various biological processes. Olfactory receptors are G protein-coupled receptors (GPCRs) that play a crucial role in the detection of odorant molecules, making them vital for sensory perception. The OR4A47 gene, specifically, is expressed in the human olfactory epithelium, highlighting its possible involvement in the sense of smell. Recent studies have suggested that variations in olfactory receptors, including OR4A47, may be linked to individual differences in olfactory perception, which can affect behaviors and preferences. Moreover, the functional characterization of OR4A47 may provide insights into its signaling pathways and interactions with specific odorants, opening doors for applications in flavor and fragrance industries. Additionally, understanding the expression patterns and functional roles of OR4A47 may contribute to the knowledge of certain olfactory-related disorders and pave the way for therapeutic interventions. Therefore, the research on OR4A47 recombinant protein is crucial for elucidating its biological functions and enhancing our overall understanding of the olfactory system.
