Analytical Data
-
Gene name
OR3A3
- Application
-
Alternative Names
OR3A3; OR3A6; OR3A7; OR3A8P; Olfactory receptor 3A3; Olfactory receptor 17-201; OR17-201; Olfactory receptor 3A6; Olfactory receptor 3A7; Olfactory receptor 3A8; Olfactory receptor OR17-22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47888
-
Expression Region
1-321 aa
-
AA Sequence
MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS LRNTDVQGALCQLLVGKRSLT
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR3A3 is a member of the olfactory receptor gene family, primarily involved in the perception of odorants and chemosensory transduction. Research into OR3A3 has gained traction due to its potential implications in understanding olfactory mechanisms and its role in various physiological processes. The olfactory receptor genes are unique for their large diversity, enabling the detection of a vast array of odorant molecules, and OR3A3 contributes to this complexity. Moreover, aberrations in olfactory receptor expression have been linked to neurological disorders and certain types of cancers, making OR3A3 a candidate for further investigation in biomedical research. Recent advances in recombinant protein technology have made it feasible to produce OR3A3 in heterologous systems, allowing for detailed studies of its structural and functional properties. This research not only enhances our understanding of the molecular basis of smell but also offers potential pathways for therapeutic innovations targeting olfactory dysfunctions or related conditions. Overall, OR3A3 serves as an important model for exploring the intricacies of olfactory signaling and its broader implications in health and disease.
