Cat: PA2000-5411

Recombinant Human AKAP13 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AKAP13

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AKAP 13; AKAP Lbc; AKAP-13; AKAP-Lbc; AKAP13; AKP13_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q12802

  • Expression Region

    2-161aa

  • AA Sequence

    KLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLDQSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHDA

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AKAP13, a member of the A-kinase anchoring protein family, plays a crucial role in cellular signaling by anchoring protein kinase A (PKA) to specific subcellular locations, thereby facilitating localized phosphorylation of target proteins. Its involvement in various physiological processes, including cardiac function, cell adhesion, and response to stress, makes it a significant focus of research. Dysregulation of AKAP13 has been implicated in several diseases, including cancer and heart disease, highlighting the importance of understanding its molecular mechanisms. The recombinant expression of AKAP13 allows researchers to investigate its structure-function relationship, explore its interactions with other signaling molecules, and assess its role in various cellular contexts. Studies utilizing recombinant AKAP13 can provide insights into its ability to modulate signaling pathways and contribute to the understanding of disease mechanisms, potentially leading to the development of targeted therapeutic strategies. Given the complexity of cellular signaling networks, dissecting the specific contributions of AKAP13 can enhance our knowledge of its function in health and disease and aid in the identification of novel biomarkers or therapeutic targets.


E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US