Analytical Data
-
Gene name
CARS2
- Application
-
Alternative Names
CARS2；Probable cysteine--tRNA ligase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HA77
-
Expression Region
1-564aa
-
AA Sequence
MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTGRKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITDVDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEVFWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWGNYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG
-
Molecular Weight
62.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CARS2, or Cytosolic Arginyl-tRNA Synthetase 2, is a relatively understudied member of the arginyl-tRNA synthetase family, which plays a crucial role in protein synthesis by attaching arginine to its corresponding tRNA. This process is vital for the translation of mRNA into functional proteins. Recent studies have indicated that CARS2 is not only involved in translational processes but may also have regulatory roles in various cellular functions, including stress responses and apoptosis. The interest in CARS2 has been piqued by emerging evidence suggesting that its dysfunction could be linked to several pathological conditions, notably neurodegenerative diseases and certain cancers. Investigating the structure and function of CARS2 can provide insights into its specific roles in cellular metabolism and pathology. Moreover, the generation of recombinant CARS2 protein is essential for elucidating its biochemical properties and interactions with other cellular molecules. By utilizing techniques such as gene cloning, expression in appropriate systems, and purification, researchers aim to dissect CARS2's functional domains and potential regulatory mechanisms. This work could pave the way for novel therapeutic strategies targeting diseases associated with CARS2 dysfunction, underscoring the importance of a comprehensive understanding of this protein in the context of both basic biology and clinical applications.
