Analytical Data
-
Gene name
BCAS2
- Application
-
Alternative Names
BCAS2；DAM1；Pre-mRNA-splicing factor SPF27
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75934
-
Expression Region
2-225aa
-
AA Sequence
AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS YLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDIT AWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQK ELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQ LENEIYQIKQQHGEANKENIRQDF
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCAS2, or Breast Cancer Amplified Sequence 2, is a gene implicated in various cancer-related processes, particularly in breast cancer. It is located on chromosome 1q24.1 and has been shown to be overexpressed in breast tumors, suggesting its potential role in tumorigenesis and cancer progression. Research has increasingly focused on the protein encoded by BCAS2, as it is believed to participate in critical cellular functions such as RNA splicing, cell cycle regulation, and apoptosis. Additionally, BCAS2 is associated with poor prognosis in breast cancer patients, making it an attractive target for therapeutic interventions. The recombinant form of BCAS2 protein is of particular interest for its potential use in diagnostics and as a target for immunotherapy. Studying the structural and functional properties of BCAS2 recombinant protein can provide valuable insights into its role in cancer biology and might aid in the development of novel treatment strategies. As research progresses, understanding how BCAS2 influences tumor behavior could lead to improved clinical outcomes for patients suffering from breast cancer and possibly other malignancies where BCAS2 expression is altered.
