Analytical Data
-
Gene name
OR2Y1
- Application
-
Alternative Names
OR2Y1; Olfactory receptor 2Y1; Olfactory receptor OR5-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGV0
-
Expression Region
1-311 aa
-
AA Sequence
MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMY FFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAF DRYAAVCRPLHYMAIMHPHLCQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEM PVFLKLACADTEGTEAKMFVARVIVVAVPAALILGSYVHIAHAVLRVKSTAGRRKAFGTC GSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTIITPILNPLIYTLRNKDVKGAL WKVLWRGRDSG
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR3A2, a member of the olfactory receptor family, has garnered attention due to its potential role in the sensory perception and signaling pathways in various physiological processes. Olfactory receptors are traditionally known for their involvement in the detection of odors, but emerging evidence suggests that they may also play roles in non-sensory tissues, contributing to diverse functions such as cell communication, immune response, and even cancer progression. The study of OR3A2 specifically is significant because it can provide insights into the broader functionalities of olfactory receptors beyond the olfactory system. Recent advances in recombinant protein technology have enabled researchers to produce and characterize OR3A2, facilitating detailed investigations into its structure, ligand specificity, and signaling mechanisms. Understanding the functional dynamics of OR3A2 may not only reveal novel aspects of sensory biology but also open new avenues for therapeutic interventions in conditions where olfactory receptor signaling is disrupted. Given the intricate relationship between olfactory receptors and various biological pathways, research on OR3A2 could potentially lead to innovative strategies in drug development and treatment protocols for a range of diseases, highlighting its importance in both basic and applied biomedical research.
