Analytical Data
-
Gene name
OR2F2
- Application
-
Alternative Names
OR2F2; Olfactory receptor 2F2; Olfactory receptor 7-1; OR7-1; Olfactory receptor OR7-6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95006
-
Expression Region
1-317 aa
-
AA Sequence
MEIDNQTWVREFILLGLSSDWCTQISLFSLFLVTYLMTVLGNCLIVLLIRLDSRLHTPMY FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY DRHVAVSDRLRYSAIMHGGLCARLAITSWVSGSINSLVQTAITFQLPMCTNKFIDHISCE LLAVVRLACVDTSSNEAAIMVSSIVLLMTPFCLVLLSYIRIISTILKIQSREGRKKAFHT CASHLTVVALCYGTTIFTYIQPHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGA WHKLLEKFSGLTSKLGT
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2F2, a member of the olfactory receptor (OR) family, is a G-protein coupled receptor (GPCR) that plays a crucial role in the sense of smell. Despite its classification as an olfactory receptor, OR2F2 is increasingly recognized for its involvement in various non-olfactory physiological processes. Recent studies have suggested that OR2F2 may be implicated in the regulation of immune responses and inflammatory pathways, highlighting its potential as a therapeutic target. The recombinant expression of OR2F2 protein enables researchers to investigate its structure-function relationships and interactome, providing insights into its mechanistic roles in both olfactory signaling and broader biological contexts. Furthermore, exploring the functional properties of OR2F2 through recombinant techniques can enhance our understanding of GPCRs and their diverse roles, paving the way for innovative approaches in drug development for conditions related to immune dysregulation and olfactory dysfunction. The ongoing elucidation of OR2F2's biological significance positions it as a key focus in the field of molecular biology and pharmacology.
