Analytical Data
-
Gene name
OR2A4
- Application
-
Alternative Names
OR2A4; OR2A10; Olfactory receptor 2A4; Olfactory receptor 2A10; Olfactory receptor OR6-37
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95047
-
Expression Region
1-310 aa
-
AA Sequence
MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFRTC FSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2A4, a member of the olfactory receptor (OR) gene family, has garnered significant interest in the field of molecular biology and pharmacology due to its role in the detection of odorants and its potential implications in various physiological processes. This receptor is predominantly expressed in human sensory tissues, particularly in the olfactory epithelium, where it plays a crucial role in the sense of smell. Recent studies have indicated that OR2A4 may also have extra-olfactory functions, such as modulating immune responses and influencing neuronal activity. The interest in OR2A4 is further fueled by its potential therapeutic applications in treating conditions related to olfactory dysfunction and other disorders. However, the functional characterization and structural analysis of OR2A4 have been challenging due to the difficulties associated with expressing and purifying this G protein-coupled receptor (GPCR) in a heterologous system. To elucidate the molecular mechanisms underlying OR2A4's functions, researchers have focused on the production of recombinant OR2A4 proteins using techniques such as gene cloning and expression in cell systems. Understanding its ligand-binding properties and signaling pathways could pave the way for novel interventions targeting olfactory and non-olfactory related disorders, making OR2A4 a promising candidate for further research in receptor biology and drug discovery.
