Analytical Data
-
Gene name
SRS
- Application
-
Alternative Names
SRSF11;SFRS11;Serine/arginine-rich splicing factor 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52788
-
Expression Region
2-366aa
-
AA Sequence
AAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANL RIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAID RYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAI MGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVL DNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDL SMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVW KKAKP
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRS (Sustainable Renewable Sourced) recombinant proteins have gained significant attention in recent years due to their potential applications in biotechnology, pharmaceuticals, and environmental sustainability. The need for alternative protein sources arises from the growing global demand for food and the adverse environmental impacts of traditional animal farming, such as greenhouse gas emissions and land degradation. The development of SRS recombinant proteins can address these challenges by providing a more sustainable, efficient, and ethical way to produce high-quality proteins. These proteins are engineered using recombinant DNA technology, which allows for the expression of specific protein sequences in host organisms, typically bacteria, yeast, or plant cells. By utilizing renewable resources and optimizing production processes, SRS recombinant proteins can be tailored for various applications, including as dietary supplements, functional food ingredients, and biologically active compounds in therapeutics. Moreover, advances in synthetic biology and protein engineering enhance the efficacy and stability of these proteins, making them viable alternatives to conventional proteins. Overall, research on SRS recombinant proteins is positioned at the intersection of innovation in food technology, environmental sustainability, and healthcare, offering promising solutions to global challenges related to food security and climate change.
