Analytical Data
-
Gene name
OR2A42
- Application
-
Alternative Names
OR2A1; OR2A42; Olfactory receptor 2A1/2A42; Olfactory receptor OR7-16; Olfactory receptor OR7-19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGT9
-
Expression Region
1-310 aa
-
AA Sequence
MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYF FLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYD RYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEI LSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL RRALGKESHS
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2A42 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sense of smell in mammals. Olfactory receptors are G protein-coupled receptors that are primarily located in the olfactory epithelium and are involved in the detection of volatile chemicals. Despite their importance in olfaction, less is understood about the functional characteristics and signaling pathways of specific olfactory receptors like OR2A42. Recent studies have indicated that OR2A42 may also be involved in non-olfactory functions, suggesting potential roles beyond traditional scent detection. The recombinant protein research on OR2A42 aims to elucidate its structure-function relationships, explore its ligand-binding properties, and investigate its potential applications in biotechnology and pharmacology. By producing OR2A42 as a recombinant protein, researchers can perform various assays to better understand its biological activities and interactions with different molecules, which may contribute to developing novel therapeutics targeting olfactory pathways or related disorders. Expanding our knowledge of OR2A42 could have broader implications for understanding the complexities of the olfactory system and its integration with other sensory modalities and physiological processes.
