Analytical Data
-
Gene name
SRP19
- Application
-
Alternative Names
SRP19;Signal recognition particle 19 kDa Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09132
-
Expression Region
1-144aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMACAAARSPADQDRFICIYPAYLNNKK TIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQ YRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQ SLQQGEGSKKGKGKKKK
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRP19, a crucial component of the signal recognition particle (SRP) pathway, plays an essential role in targeting membrane and secretory proteins to the endoplasmic reticulum (ER) in eukaryotic cells. This protein is involved in the formation of the SRP complex, which is pivotal for recognizing and binding to the ribosome-nascent chain complex. The SRP pathway is vital for maintaining cellular function and homeostasis, as it facilitates the proper localization of proteins, thereby ensuring their correct folding and functional activity. Given its importance, studies on SRP19 recombinant protein focus on elucidating its structural and functional properties, as well as its interactions within the SRP complex. Research in this area has implications for understanding various cellular processes, including protein synthesis and translocation, with potential applications in biotechnology and medicine, such as developing therapeutics targeting misfolded proteins associated with certain diseases. Understanding SRP19 can also provide insights into evolutionary biology, as the protein's conservation across different organisms indicates its fundamental role in cellular processes. Advances in recombinant DNA technology enable the production of SRP19 for detailed biochemical studies, paving the way for potential innovative applications in drug development and protein engineering. Thus, elucidating the characteristics and mechanisms of SRP19 holds significant promise for both basic research and applied sciences.
