Analytical Data
-
Gene name
OR2A1
- Application
-
Alternative Names
OR2A1; OR2A42; Olfactory receptor 2A1/2A42; Olfactory receptor OR7-16; Olfactory receptor OR7-19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGT9
-
Expression Region
1-310 aa
-
AA Sequence
MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYF FLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYD RYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEI LSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL RRALGKESHS
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR2A1 gene, part of the olfactory receptor gene family, encodes a receptor that plays a crucial role in the sense of smell. As an olfactory receptor, OR2A1 is responsible for detecting specific odorant molecules in the environment, contributing to the complex mechanism of olfaction. Research on OR2A1 has gained significant attention due to its potential implications in understanding olfactory signaling pathways, which can affect various physiological processes and behaviors. Additionally, studies suggest that variations in the OR2A1 gene may be linked to individual differences in smell perception and preferences, which can have broader implications for areas such as taste, nutrition, and even emotional responses. The production of recombinant OR2A1 protein allows scientists to investigate its structure and function in detail, offering insights into its role in the olfactory system. This research not only enhances our understanding of sensory biology but also opens avenues for exploring therapeutic strategies for anosmia (loss of smell) or related disorders. Understanding the functional dynamics of OR2A1 could lead to advancements in flavor and fragrance industries, as well as the development of more effective strategies for enhancing sensory experiences. Overall, the study of recombinant OR2A1 proteins sits at the intersection of molecular biology, neuroscience, and sensory research, highlighting its significance in both basic science and applied fields.
