Analytical Data
-
Gene name
SRP14
- Application
-
Alternative Names
SRP14;Signal recognition particle 14 kDa Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37108
-
Expression Region
1-160aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMVLLESEQFLTELTRLFQKCRTSGSV YITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKK ISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAA PAAAATAATTAATTAATAAQ
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRP14, or Signal Recognition Particle 14 kDa protein, plays a critical role in the signal recognition particle (SRP) complex, which is essential for targeting nascent polypeptides to the endoplasmic reticulum (ER) for proper translocation and processing. The SRP pathway is fundamental for maintaining cellular homeostasis and ensuring that protein synthesis occurs in the correct cellular compartment. Research into SRP14 is particularly important due to its involvement in various physiological processes and its potential implications in diseases linked to protein misfolding and trafficking. Understanding the structure and function of SRP14 can provide insights into the molecular mechanisms of SRP-dependent protein targeting, highlighting its importance in both basic biology and potential therapeutic applications. Furthermore, as a recombinant protein, SRP14 can be utilized in biochemical assays to elucidate its interactions and regulatory mechanisms within the SRP complex. This research holds promise for uncovering novel strategies to modulate protein synthesis pathways, which may have significant implications for developing treatments for diseases such as cystic fibrosis, cancer, and neurodegenerative disorders, where protein misfolding is a key factor. Thus, the study of SRP14 not only enriches our understanding of cellular processes but also paves the way for innovative approaches to therapeutic intervention in a variety of diseases.











