Analytical Data
-
Gene name
SRM
- Application
-
Alternative Names
SRM;SPS1;SRML1;Spermidine synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19623
-
Expression Region
17-302aa
-
AA Sequence
REGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS
-
Molecular Weight
59.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRM (Selectivity Receptor Modulators) is an exciting area of research that focuses on developing proteins designed to selectively modulate receptor activities, potentially offering therapeutic benefits for various diseases, including cancer, diabetes, and neurodegenerative disorders. The need for SRM is driven by the limitations of traditional drugs, which often lack specificity and can cause undesirable side effects. By engineering proteins with precise affinities for specific receptors, researchers aim to enhance therapeutic efficacy while minimizing adverse reactions. The development of SRMs involves advanced techniques such as protein engineering, molecular dynamics simulations, and high-throughput screening to identify and optimize candidates with desired pharmacological profiles. Recent findings have shown that SRMs can effectively alter receptor pathways, leading to the modulation of cellular responses in a targeted manner. This capability not only opens up new avenues for treatment but also contributes to the understanding of receptor biology. As the field progresses, the integration of SRM technology with personalized medicine holds the promise of creating tailored therapies that align with individual patient profiles, ushering in a new era of precision medicine. Overall, the exploration of SRMs represents a significant advancement in drug discovery, with the potential to revolutionize therapeutic approaches for a variety of challenging diseases.
