Analytical Data
-
Gene name
OR1S2
- Application
-
Alternative Names
OR1S2; Olfactory receptor 1S2; Olfactory receptor OR11-231
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGQ3
-
Expression Region
1-325 aa
-
AA Sequence
MKTLCSFLQISRNMHQENQTTITEFILLGLSNQAEHQNLLFVLFLSMYVVTVVGNGLIIV AISLDIYLHTPMYLFLAYLSFADISSISNSVPKMLVNIQTNSQSISYESCITQMYFSIVF VVTDNLLLGTMAFDHFVAICHPLNYTTFMRARFGTLLTVISWFLSNIIALTHTLLLIQLL FCDHNTLPHFFCDLAPLLKLSCSDTMINELVLFIVGLSVIIFPFVLIFFSYVCIIRAVLG VSSTQGKWKAFSTCGSHLTIALLFYGTTVGVYFFPSSTHPEDTDKIGAVLFTVVTPMMNP FIYSLRNKDMKGALRKLINRKISSL
-
Molecular Weight
36.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR1S2 is a member of the olfactory receptor gene family, which plays a crucial role in the sensory perception of odors. Research on OR1S2 and its recombinant proteins has gained significance due to the increasing understanding of the molecular mechanisms underlying olfactory signaling. Studies have shown that olfactory receptors, including OR1S2, are not only pivotal in detecting a wide array of odorants but may also have functions beyond the olfactory system, potentially impacting various physiological processes. The expression and characterization of OR1S2 as a recombinant protein allow for a deeper exploration of its binding affinity with specific ligands and its role in signal transduction pathways. Furthermore, elucidating the structure-function relationship of OR1S2 can provide insights into the evolution of olfactory receptors and their diverse functionalities across different species. This research is essential for applications in fields such as pharmacology, where understanding these receptors can lead to the development of novel therapeutic agents targeting olfactory pathways. Overall, the investigation of OR1S2 recombinant protein serves as a foundation for advancing our knowledge of the olfactory system and its implications in health and disease.
