Cat: PA1000-3008

Recombinant Human SPOP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SPOP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPOP;Speckle-type POZ Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43791

  • Expression Region

    1-374aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSRVPSPPPPAEMSSGPVAESWCYTQIKVV KFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEES KDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKD WGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFE HEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHAS DVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SPOP (Speckle-type POZ protein) is an E3 ubiquitin ligase that plays a critical role in the regulation of protein degradation and various cellular processes, including cell cycle progression, apoptosis, and transcriptional regulation. Its function is particularly significant in the context of cancer, where mutations or dysfunction in SPOP have been linked to the development and progression of several malignancies, especially prostate cancer. The identification of SPOP as a tumor suppressor suggested its potential as a therapeutic target, highlighting the importance of understanding its structural and functional characteristics. Research on recombinant SPOP proteins has gained momentum as scientists seek to elucidate its mechanisms of action, regulatory pathways, and interactions with substrates like the androgen receptor. Moreover, recombinant SPOP proteins provide a valuable tool for studying the effects of mutations and post-translational modifications on its activity. Characterizing SPOP through protein engineering and functional assays can help discover new insights into its involvement in cancer biology and pave the way for novel therapeutic strategies. This growing body of research underscores the need for detailed analysis of SPOP's roles at the molecular level, aiming to translate findings into clinical applications for cancer treatment and prevention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US