Cat: PA1000-3009

Recombinant Human SPRED1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SPRED1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPRED1;Sprouty-related. EVH1 domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z699

  • Expression Region

    2-444aa

  • AA Sequence

    SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQE ENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGL TFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSL VKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPG LDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPR DILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETK LSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGK CQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFC LRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SPRED1 (Sprouty-related EVH1 domain-containing protein 1) is a crucial adaptor protein involved in cellular signaling pathways, particularly those related to the RAS-MAPK (mitogen-activated protein kinase) pathway, which plays a significant role in cell proliferation, differentiation, and survival. Mutations in the SPRED1 gene have been associated with clinical conditions such as Neurofibromatosis type 1 (NF1) and various malignancies, highlighting its importance in cellular signaling and oncology. Research into the recombinant SPRED1 protein has gained prominence as it allows scientists to investigate the functional aspects of SPRED1, including its interactions with other signaling molecules, its role in modulating RAS signaling, and its potential as a therapeutic target. Recombinant SPRED1 protein can be produced using various expression systems, enabling detailed structural and biophysical characterization as well as biological activity assays. These studies may reveal insights into the mechanistic underpinnings of diseases linked to SPRED1 dysregulation and facilitate the development of novel therapeutic strategies aimed at targeting specific pathways influenced by SPRED1. Understanding the role of SPRED1 at the molecular level could provide significant advancements in the fields of cancer research and developmental biology, ultimately contributing to the identification of new biomarkers and therapeutic interventions for conditions associated with RAS signaling dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US